6DM4A

Crystal structure of the sh2 domain from ravo (lpg1129) from legionella pneumophila in complex with homo sapiens shc1 phospho-tyr317 peptide
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
SEKIYKVMEEIFVDRHYKENIRTGEEVKQYFSKSKAEFILRWSSANESDTENKYVFIAASFQASDGIHSIRYGINKNGELFSINTASNKVTPIDILPLGVMATLTQHITQNKELIEKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the SH2 domain from RavO (Lpg1129) from Legionella pneumophila in complex with Homo sapiens Shc1 phospho-Tyr317 peptide
rcsb
molecule tags Protein binding
source organism Legionella pneumophila subsp. pneumophila (strain philadelphia 1 / atcc 33152 /
molecule keywords RavO
total genus 30
structure length 119
sequence length 119
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2018-06-04
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...