6DQXA

Actinobacillus ureae class id ribonucleotide reductase alpha subunit
Total Genus 216
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
216
sequence length
545
structure length
520
Chain Sequence
TRPDFEWLNEDSRLFLQRGYLLEGTTALERIRFIAEHAEHKLGIEGYADKFYHYMARGYFSLSSPIWSNFGLDRGLPISCFGSYIGDSIHEIMVTTAEVGMMSKIGGGTSAYFGDIRPRGSAIKSDGSFNFSKLFDTVIDVISQGQFAGYIDIEHGDIDEWLDIHTEGNPIQLMYYGVCVGHDWLESMKAGDPYKRQLWAKLLQRKTETGIPYLFFKDNANAGRPDVYKDKNMTVHASNLCTEIMLPSSNDESFVCCLSSMNLLYFDEWKDTEAPEVLTYFLDVVMSEFIEKSKDMPFLDRAHRFATRHRALGLGVLGWHSYLQANNIAFDSFQAMQKNNLIFKTLQEKTLKASQELAKRFGEPEILKGYGRRNTTLMSIAPTKSSSFILGSVSPSVEPFKSNYYYKNPFLEKLLQEKGLDTEEIWESILHNDGSVQHLEQLTDEEKEVFKTFSEISQLSVIQQAAQRQKYIDQGQSINIMVHPATPARDLNQLYLTAEELGLKSIYYQYSMSANLLSCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of Class Id Ribonucleotide Reductase Catalytic Subunits Reveal a Minimal Architecture for Deoxynucleotide Biosynthesis.
pubmed doi rcsb
molecule keywords Ribonucleoside-diphosphate reductase, alpha chain
molecule tags Oxidoreductase
source organism Actinobacillus ureae atcc 25976
total genus 216
structure length 520
sequence length 545
ec nomenclature ec 1.17.4.1: Ribonucleoside-diphosphate reductase.
pdb deposition date 2018-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02867 Ribonuc_red_lgC Ribonucleotide reductase, barrel domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...