6DRDE

Rna pol ii(g)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
205
structure length
185
Chain Sequence
ETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQTDLTVLVAHNQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGSAKQSLVDMAPKYILEQFLEQELLINITEHELVPEHVVMTKEEVSELLARYKLRENQLPRIQAGDPVARYFGIRRGQVVKIIRPSETAGRYITYRLVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Architecture of Pol II(G) and molecular mechanism of transcription regulation by Gdown1.
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 34
structure length 185
sequence length 205
ec nomenclature
pdb deposition date 2018-06-11
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...