6DS1A

Crystal structure of cj0485 dehydrogenase in complex with nadp+
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
258
structure length
258
Chain Sequence
b'MDLKIKNKVCIITGGAKGIGYGIAKLWASEGGIPVIFSRSMPKEHDKELKKLSSEYEFYEIDLKNYEQIEKLVKKVAIKHGGIYALVNNAGTNDNLHIENTSTQDLIKSYENNLFHYYTMTKECLPYIKKEQGSILNIVSKTGITGQGRTSAYASAKAAQMGFTREWACAFAKDNVRVNAIAPAEVMTPLYEKWLQNFPNPKEQYEKIAKAIPLGHRFTTIEEIANTAVFTLSPLASHTTGQILMPDGGYVHLDRALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative oxidoreductase
publication title No longer asaccharolytic - L-fucose and D-arabinose metabolism in Campylobacter jejuni
rcsb
source organism Campylobacter jejuni subsp. jejuni serotype o:2 (strain atcc 700819 / nctc 11168
molecule tags Oxidoreductase
total genus 94
structure length 258
sequence length 258
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2018-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...