6DTCA

Dihydrofolate reductase (dhfr) of aspergillus flavus in complex with a small molecule inhibitor
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
245
structure length
244
Chain Sequence
PTNPLTLIVATTPIPTREKTLLGIGLNGTLPWPRIKADMSFFARVTTRPPRPGTTNAMIMGRKTYDSVPKSLRPLGKRINVIVTRDVEGVSKRVAEELKEKRAKMAAAAAAATSAGENKEEGPITDAIVSSGLEAALEDVEEKFKGGLGSVFVIGGAEIYATALGLGGRPVRIVMTNVEKKGVDGEKAVFECDTFFPIDEELLMEKGWRKVSAEEVTEWVGEPVSGEWKDEGEVRIQMVGYERV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antifungal protein/inhibitor
molecule keywords Dihydrofolate reductase
publication title Prospecting for broad-spectrum inhibitors of fungal dihydrofolate reductase using a structure guided approach.
rcsb
source organism Aspergillus flavus
total genus 70
structure length 244
sequence length 245
ec nomenclature
pdb deposition date 2018-06-15
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...