6DVBE

Crystal structure of mycobacterium tuberculosis transcription initiation complex(ecf sigma factor l) containing 5nt rna with 5nt spacer
Total Genus 18

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
GYDTPLGITNPPIDELLDRVSSKYALVIYAAKRARQINDYYNQLGEGILEYVGPLVEPGLQEKPLSIALREIHADLLEHTE

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
TII'1 (33-36)TI1 (34-37)TI3 (70-73)AH1 (40-44)AH2 (50-70)TIV2 (74-77)EMPTYTIV1 (36-39)Updating...
connected with : NaN
molecule tags Transferase/dna/rna
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
publication title Structural basis of ECF-sigma-factor-dependent transcription initiation.
pubmed doi rcsb
molecule keywords DNA-directed RNA polymerase subunit alpha
total genus 18
structure length 81
sequence length 81
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2018-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01192 RNA_pol_Rpb6 RNA polymerase Rpb6
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.