6DVBF

Crystal structure of mycobacterium tuberculosis transcription initiation complex(ecf sigma factor l) containing 5nt rna with 5nt spacer
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
174
structure length
174
Chain Sequence
VSGAAAAEAALMRALYDEHAAVLWRYALRLTGDAAQAEDVVQETLLRAWQHPEVIGDTARPARAWLFTVARNMIIDERRSARFRNVVGSTDQSGTPEQSTPDEVNAALDRLLIADALAQLSAEHRAVIQRSYYRGWSTAQIATDLGIAEGTVKSRLHYAVRALRLTLQELGVTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of ECF-sigma-factor-dependent transcription initiation.
pubmed doi rcsb
molecule keywords DNA-directed RNA polymerase subunit alpha
molecule tags Transferase/dna/rna
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
total genus 53
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2018-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF04542 Sigma70_r2 Sigma-70 region 2
F PF04545 Sigma70_r4 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...