6E3TA

Crystal structure of the heterodimeric hif-2 complex with antagonist t1001
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
361
structure length
245
Chain Sequence
NKMTAYITELSDMVPTCSALARKPDKLTILRMAVSHMKSLELKHLILEAADGFLFIVSCETGRVVYVSDSVTPVLNQPQSEWSTLYDQVHPDDVDKLREQLSRRSFICRMRCGTPHFVVVHCTGYIKAWKFCLVAIGRLQVTTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKTREWLWMRTSSFTFQNPYSDEIEYIICTNTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bidirectional modulation of HIF-2 activity through chemical ligands.
pubmed doi rcsb
molecule keywords Aryl hydrocarbon receptor nuclear translocator
molecule tags Transcription/transcription inhibitor
source organism Mus musculus
total genus 57
structure length 245
sequence length 361
ec nomenclature
pdb deposition date 2018-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00010 HLH Helix-loop-helix DNA-binding domain
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...