6EBPA

Crystal structure of the class ie ribonucleotide reductase beta subunit from aerococcus urinae in activated form
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
303
structure length
302
Chain Sequence
NYYDRSVSPVEYAYFDQSQNMRAINWNKIVDEKDLEVWNRVTQNFWLPENIPVSNDLPSWNELDDDWQQLITRTFTGLTLLDTVQSSIGDVAQIKNSLTEQEQVIYANFAFMVGVHARSGTIFSTLCTSEQIEEAHEWVVDNEALQARPKALIPFYTADDPLKSKIAAALMPGFLLYGGFYLPFYLSARGKLPNTSDIIRLILRDKVIHNFYSGYKYQLKVAKLSPEKQAEMKQFVFDLLDKMIGLEKTYLHQLYDGFGLADEAIRFSLYNAGKFLQNLGYESPFTKEETRIAPEVFAQLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Metal-free class Ie ribonucleotide reductase from pathogens initiates catalysis with a tyrosine-derived dihydroxyphenylalanine radical.
pubmed doi rcsb
molecule tags Oxidoreductase
source organism Aerococcus urinae (strain acs-120-v-col10a)
molecule keywords Ribonucleoside-diphosphate reductase, beta subunit
total genus 125
structure length 302
sequence length 303
chains with identical sequence B, C, D
ec nomenclature ec 1.17.4.1: Ribonucleoside-diphosphate reductase.
pdb deposition date 2018-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00268 Ribonuc_red_sm Ribonucleotide reductase, small chain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...