6ELYA

Crystal structure of mistletoe lectin i (ml-i) from viscum album in complex with 4-n-furfurylcytosine at 2.84 a resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
249
structure length
249
Chain Sequence
YERLSLRTVQQTTGAEYFSFITLLRDFVSSGSFSNNIPLLRQSTIPVSEGSRFVLVELTNAGGDSVTAAIDVTNLYVVAYQAGQQSYFLKDAPAGAETQDFTGTTRSSLPFNGSYPDLERYAGHRDQIPLGIDQLIQSVTALRFPGGSTRTQARSILILIQMISEAARFDPILWRARQYINSGASFLPDVYMLELETSWGQQSTQVQHSTDGVFNNPIRLALSPGNVVTLTNVRDVIASLAIMLFVCGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Mistletoe Lectin I (ML-I) from Viscum album in Complex with 4-N-Furfurylcytosine at 2.85 angstrom Resolution.
pubmed doi rcsb
molecule keywords Mistletoe Lectin I
molecule tags Hydrolase
total genus 68
structure length 249
sequence length 249
ec nomenclature ec 3.2.2.22: rRNA N-glycosylase.
pdb deposition date 2017-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00161 RIP Ribosome inactivating protein
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...