6EM3D

State a architectural model (nsa1-tap flag-ytm1) - visualizing the assembly pathway of nucleolar pre-60s ribosomes
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
215
structure length
194
Chain Sequence
GYVVCDSDKRFLLLFSFLKRNQKKKIIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILICTDVAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRGKSLMFLTPNPLNEYEFPENKIANVQSQLEKLIKSNYYLHQTAKDGYRSYLQAYASHSLKTVYQIDKLDLAKVAKSYGFPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords Ribosome production factor 1
total genus 29
structure length 194
sequence length 215
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2017-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00270 DEAD DEAD/DEAH box helicase
D PF00271 Helicase_C Helicase conserved C-terminal domain
D PF13959 DUF4217 Domain of unknown function (DUF4217)
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...