6EOAA

Crystal structure of hal3 from cryptococcus neoformans
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
207
structure length
193
Chain Sequence
DGIFRVVLITSGSVASIKAPDIVGALVKSPNIDVQVVATKASTYFYSQEDVDNSVRSALNLPDGQTGEHFGVRVWTDEDEWSGEPILHIELRRWADLVVIAPCSADLLAKIAGGICDSLATSLLRALGPSTPVIVCPAMNTYMYQHRLTTRHLAVVQEDLGYLVSGPQGGPGKMTDWRDIVSLIEGFATMHQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Flavoprotein
molecule keywords Phosphopantothenoylcysteine decarboxylase
publication title Characterization of the atypical Ppz/Hal3 phosphatase system from the pathogenic fungus Cryptococcus neoformans.
pubmed doi rcsb
source organism Cryptococcus neoformans
total genus 66
structure length 193
sequence length 207
ec nomenclature
pdb deposition date 2017-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02441 Flavoprotein Flavoprotein
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...