6EP7A

Arabidopsis thaliana gstu23, gsh bound
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
210
structure length
210
Chain Sequence
EIILLDYWASMYGMRTRIALEEKKVKYEYREEDLSNKSPLLLQMNPIHKKIPVLIHEGKPICESIIQVQYIDELWPDTNPILPSDPYQRAQARFWADYIDKKTYVPCKALWSESGEKQEAAKIEFIEVLKTLDSELGDKYYFGGNEFGLVDIAFIGFYSWFRTYEEVANLSIVLEFPKLMAWAQRCLKRESVAKALPDSDKVLKSVSDHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Disulfide bond formation protects Arabidopsis thaliana glutathione transferase tau 23 from oxidative damage.
pubmed doi rcsb
molecule tags Transferase
source organism Arabidopsis thaliana
molecule keywords Glutathione S-transferase U23
total genus 77
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2017-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...