6EXDA

Crystal structure of dotm cytoplasmic domain (residues 153-380) semet derivative
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
223
structure length
214
Chain Sequence
PWAMALTPMEFARKYNLLRKDDEEMTAGIRRGDAKRVFTMQLGPYWDGFERCSPQAYALSAVFMARMNRDRDAANNILKVLDKTFVDGKPDFSVARPVMKKYQNSELVQEVVAKHAYVLTVIASLLEAAREDGVVPSSEFLWLKPVDRRLWYMLNCVGRQTPYSEVAGPFAHWKAEKEMGRRSLVPMIDEAIRALEIAVKEVRLTPRQMEELEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Legionella DotM structure reveals a role in effector recruiting to the Type 4B secretion system.
pubmed doi rcsb
molecule tags Protein binding
source organism Legionella pneumophila subsp. pneumophila (strain philadelphia 1 / atcc 33152 /
molecule keywords IcmP (DotM)
total genus 62
structure length 214
sequence length 223
chains with identical sequence B
ec nomenclature
pdb deposition date 2017-11-07
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...