6EXRA

Chemotaxis protein chey from pyrococcus horikoshii
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
117
structure length
117
Chain Sequence
ARVLVVDDAAFMRMLLKKILTQAGHEVVGEASNGKEAVEKYKQLKPDLVTMDIVMPEMDGITAVKEIMKIDPNAKIIMITAVGQEAKVMEALKSGAKGYIVKPFQAQKVIEEVNRVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Chemotaxis protein CHEY from Pyrococcus horikoshiI
rcsb
molecule keywords 120aa long hypothetical chemotaxis protein (CheY)
molecule tags Signaling protein
source organism Pyrococcus horikoshii (strain atcc 700860 / dsm 12428 / jcm 9974 / nbrc 100139 /
total genus 35
structure length 117
sequence length 117
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2017-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...