6EZSA

Crystal structure of gh20 exo beta-n-acetylglucosaminidase from vibrio harveyi in complex with n-acetylglucosamine
Total Genus 222
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
222
sequence length
639
structure length
639
Chain Sequence
SEYRVDLVVLSEQKQNCRFGLTFHNLSDQDLNSWGLTFAFDRYILPDSVSNGQLTQIGSFCTLKPEGIVLAANHHYYCEFSIGSNPFRYYSDGFNEAMIDFVVDGQPQRAQVDVTPIVLASPYRERSDIPASLTHAQPLLPKPNHIEVSDHSFTFDEQAGVAIYTDLANSAKAWLLEELQRIHQFTLSSSNSGKIIFKSNPTLDEGAYKLKVSEESIKIEAGSSSGFTHACATLLQLLKRDEATKTMEAVCCSIIDSPRFRYRGMMLDCARHFHSVEQVKRLINLLAHYKLNTFHWHLTDDEGWRVEIKSLPQLTEIGAWRGIDETIEPQYTHLSQRYGGFYTQEEIRDVIAFAEQRGITIIPEIDVPGHCRAAIKSLPHLLIEAEDTTEYRSIQHYNDNVINPALPGSYEFIDKVLEEIAALFPAPYVHIGADEVPNGVWSKSPACQALMEQLGYTDYKELQGHFLRHAEDKLRKLGKRMLGWEEAQHGNKVSKDTVIYSWLSEEAALNCARQGFDVVLQPAQTTYLDMTQDYAPEEPGVDWANPLPLEKAYNYEPLAEVPADDPIRKRIWGIQTALWCEIINNPSRMDYMIFPRLTAMAEACWTEKQHRDWTDYLSRLKGHLPLLDLQGVNYRKPWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi
rcsb
molecule tags Hydrolase
source organism Vibrio harveyi
molecule keywords Beta-N-acetylglucosaminidase Nag2
total genus 222
structure length 639
sequence length 639
chains with identical sequence B
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2017-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
A PF02838 Glyco_hydro_20b Glycosyl hydrolase family 20, domain 2
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...