6F2UA

Potent and selective aldo-keto reductase 1c3 (akr1c3) inhibitors based on the benzoisoxazole moiety: application of a bioisosteric scaffold hopping approach to flufenamic acid
Total Genus 116

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
314
structure length
314
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPY
5010015020025030030025020015010050
020406080100Genus Matrix

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
S1 (7-9)3H2 (39-44)TI'1 (10-13)3H11 (255-263)S2 (15-17)S10 (266-269)TIV1 (17-20)S3 (19-22)TIV14 (215-218)TI'2 (26-29)EMPTY3H1 (31-34)TI'3 (35-38)TI'8 (60-63)3H5 (76-78)3H3 (53-55)3H6 (96-98)TIV6 (99-102)TI'5 (57-60)TI'6 (58-61)TI'7 (59-62)TI'9 (61-64)3H4 (65-67)TIV3 (67-70)3H7 (103-106)TI'11 (68-71)S5 (80-85)TIV4 (86-89)TI1 (132-135)TIV5 (87-90)TI'13 (98-101)TIV9 (158-161)S6 (111-116)S7 (160-165)TI3 (308-311)AH1 (144-147)TII1 (179-182)3H8 (150-157)AH2 (170-178)TI5 (311-314)AH3 (200-205)TIV11 (205-208)S8 (188-192)S9 (212-216)TI2 (229-232)TIV16 (238-241)TIV17 (239-242)3H10 (243-245)TI'17 (246-249)TIV18 (245-248)TI'19 (273-276)TIV19 (251-254)3H12 (277-282)3H13 (292-295)TI'21 (282-285)TI'22 (283-286)TI'23 (289-292)TI4 (309-312)TIV8 (127-130)TIV12 (206-209)TIV13 (207-210)TIV15 (225-228)TIV2 (34-37)S4 (48-50)TI'15 (217-220)3H9 (235-237)Updating...
connected with : NaN
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Potent and selective aldo-keto reductase 1C3 (AKR1C3) inhibitors based on the benzoisoxazole moiety: application of a bioisosteric scaffold hopping approach to flufenamic acid.
pubmed doi rcsb
molecule keywords Aldo-keto reductase family 1 member C3
total genus 116
structure length 314
sequence length 314
chains with identical sequence B
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2017-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.