6F43A

Crystal structure of apo form of glutathione transferase omega 3s from trametes versicolor
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
241
structure length
241
Chain Sequence
TKQITLYTATFSPYAHRVRIALEEAGAEYTTYDVDILRNMPDWFPLVNPLKKIPAMTFGGPEVPPDQPSPESAKIAESLAMLEFIADLFPDAKLLPTDPVLRARARTFMALYENYVNGQFRDVWFLGTPADPLLQALEMLQGALPPDGGFAAGEWSIADAAVIPFLARMFPYLEAGLGLYSKEDGVKMRKAMASERFARIRQYVRDCRARPSFANTWAGDAEQVEAAKTVPMLRVGEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular recognition of wood polyphenols by phase II detoxification enzymes of the white rot Trametes versicolor.
pubmed doi rcsb
molecule keywords glutathione transferase
molecule tags Transferase
source organism Trametes versicolor
total genus 77
structure length 241
sequence length 241
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2017-11-29
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...