6F6KA

R2-like ligand-binding oxidase v72l mutant with anaerobically reconstituted mn/fe cofactor
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
284
structure length
272
Chain Sequence
HHDGFQTVKATIDWEHPMFKLYEKAKRNGKWNPADIDFSQDQKDFASLTSEEKISALPLVAGFSAGEEALTLDILPMAHALARQGRLEDVLFLTTFMHDEAKHVEMFSRWQQAVGIGQMDLSVFHNDHYKRIFYEALPEAMNRLYADDSPEAVIRAATVYNMIVEGTLAESGYYTFRQIYKKAGLFPGLLQGIDYLNMDEGRHIQFGIYTIQRIVNEDERYYELFIRYMDELWPHVIGYVDYLTELGKIDYDLLRHYVIKQFNLRKKQISRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ribonucleotide reductase small subunit
publication title Ether cross-link formation in the R2-like ligand-binding oxidase.
pubmed doi rcsb
source organism Geobacillus kaustophilus (strain hta426)
total genus 119
structure length 272
sequence length 284
chains with identical sequence B
ec nomenclature ec 1.17.4.1: Ribonucleoside-diphosphate reductase.
pdb deposition date 2017-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00268 Ribonuc_red_sm Ribonucleotide reductase, small chain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...