6FBKA

Crystal structure of the human wnk2 cct-like 1 domain in complex with a wnk1 rfxv peptide
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
90
structure length
83
Chain Sequence
EDTGVRVELAEEDHGRKSTIALRLWVEDPKDNGAIEFTFDLEKETPDEVAQEMIESGFFHESDVKIVAKSIRDRVALIQWRRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the human WNK2 CCT-like 1 domain in complex with a WNK1 RFXV peptide
rcsb
molecule tags Peptide binding protein
source organism Homo sapiens
molecule keywords Serine/threonine-protein kinase WNK2
total genus 17
structure length 83
sequence length 90
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2017-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12202 OSR1_C Oxidative-stress-responsive kinase 1 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...