6FG8B

Crystal structure of the bir3 - serk1 complex from arabidopsis thaliana.
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
189
structure length
189
Chain Sequence
EDDVLCLQGLKNSLIDPSSRLSSWSFPNSSASSICKLTGVSCWNEKENRIISLQLQSMQLAGEIPESLKLCRSLQSLDLSGNDLSGSIPSQICSWLPYLVTLDLSGNKLGGSIPTQIVECKFLNALILSDNKLSGSIPSQLSRLDRLRRLSLAGNDLSGTIPSELARFGGDDFSGNNGLCGKPLSRCGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The SERK3 elongated allele defines a role for BIR ectodomains in brassinosteroid signalling.
pubmed doi rcsb
molecule tags Protein binding
source organism Arabidopsis thaliana
molecule keywords Somatic embryogenesis receptor kinase 1
total genus 58
structure length 189
sequence length 189
ec nomenclature
pdb deposition date 2018-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08263 LRRNT_2 Leucine rich repeat N-terminal domain
B PF13516 LRR_6 Leucine Rich repeat
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...