6FW4A

Protein-protein interactions and conformational changes : importance of the hydrophobic cavity of tola c-terminal domain
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
101
structure length
101
Chain Sequence
AARQQFVTSEVGRYGAIYTQLIRQNLLVEDSFRGKQCRVNLKLIPTGTGALLGSLTVLDGDSRLCAATKRAVAQVNSFPLPKDQPDVVEKLKNINLTVAPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Induced fit conformational changes of Vibrio cholerae TolAIII domain during the complex formation with the viral PIIIN1 domain: Structural and High-pressure NMR studies.
rcsb
molecule tags Protein binding
source organism Vibrio cholerae
molecule keywords TolA protein
total genus 24
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2018-03-05
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...