6GAZAO

Unique features of mammalian mitochondrial translation initiation revealed by cryo-em. this file contains the 28s ribosomal subunit.
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
175
structure length
175
Chain Sequence
QDDPPPSMLLLDYQNVPGIHKVDDVVKRLLSLEMANQKEKLKIKKMQLMNKVLENPEDTSSLEARIVALTVKIRNYEEHMQKHRKDKAHKRFLLMSIDQRKKMLKNLRETNYAVFEKICKELGIEYTFPPPYHRKAHRRWVTKKALCTQVFREVQKLKKQKRALRAAAVAAHKQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM.
pubmed doi rcsb
molecule tags Ribosome
source organism Homo sapiens
molecule keywords Translation initiation factor IF-2, mitochondrial
total genus 53
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2018-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
AO PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...