6GB2BJ

Unique features of mammalian mitochondrial translation initiation revealed by cryo-em. this file contains the 39s ribosomal subunit.
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
212
structure length
212
Chain Sequence
GSKAVTRHRRVMHFERQKLMAVTEYIPPKPTINPRCLPPPPTPPQEETGLVRLLRREIAAVFRDNRMIAVCQHVALSAEDKLLLRHQLRKHKILMKIFPNQVLKPFLEESKYQNLLPLFVGHNLLLVSEEPKVKEMVRILKGIPFLPLLGGCIDDTILSRQGFINYSKLPSLALVQGELVGGLTFLTAQTYSMLQHQPRQLTALLDQYVKQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM.
pubmed doi rcsb
molecule tags Ribosome
source organism Homo sapiens
molecule keywords Mitochondrial ribosomal protein L12
total genus 40
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2018-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
BJ PF00466 Ribosomal_L10 Ribosomal protein L10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...