6H5NC

Plasmodium falciparum pfs48/45 c-terminal domain bound to monoclonal antibody 85rf45.1
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
218
structure length
207
Chain Sequence
EVQLVESGGGLLQPGRSLKLSCVASGFTFNNYWMSWIRQAPGKGLEWIASISNIGGTIYYPDSVKGRFTISRDSAQNTLYLQMNSLRSEDTATYYCTRDLRMSDYFDYWGQGVMVTVSSAETTAPSVYPLATLGCLVKGYFPEPVTVTWNSGALSSGVHTFPAVLQSGLYTLTSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell invasion
molecule keywords Gametocyte surface protein P45/48
publication title Structural basis for recognition of the malaria vaccine candidate Pfs48/45 by a transmission blocking antibody.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 31
structure length 207
sequence length 218
chains with identical sequence F
ec nomenclature
pdb deposition date 2018-07-25
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...