6HIVCq

Cryo-em structure of the trypanosoma brucei mitochondrial ribosome - this entry contains the complete mitoribosome
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
252
structure length
252
Chain Sequence
YHAYVPKGASVQMGETFMPSNIATAVFRETEAAAARADKTKEETGFFSQPRLNYPVSSGIPALFSKDQFDMQYSLFHRDVVETLNRHTLGTPLEGHNLETVIRKTSFDATQAVAHTAASEHFNYCFFYKSLRPWGTAPPPRLREALQLQYGTNGSADAMDEVRRIVWVTAASHQERCGWVYLVWSGVHFDVVEFPHGSCPIASDLIPLLALNVHESAYILDYGTSGLKQYVENYFKACNWPLAERYYLMAIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
pubmed doi rcsb
molecule keywords ms48
molecule tags Ribosome
source organism Trypanosoma brucei brucei
total genus 70
structure length 252
sequence length 252
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2018-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Cq PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
Cq PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...