6HU9e

Iii2-iv2 mitochondrial respiratory supercomplex from s. cerevisiae
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
133
structure length
133
Chain Sequence
AQTHALSNAAVMDLQSRWENMPSTEQQDIVSKLSERQKLPWAQLTEPEKQAVWYISYGEWGPRRPVLNKGDSSFIAKGVAAGLLFSVGLFAVVRMAGGQDAKTMNKEWQLKSDEYLKSKNANPWGGYSQVQSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of yeast cytochrome c oxidase in a supercomplex with cytochrome bc1.
pubmed doi rcsb
molecule tags Oxidoreductase/electron transport
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
total genus 35
structure length 133
sequence length 133
chains with identical sequence q
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2018-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
e PF02936 COX4 Cytochrome c oxidase subunit IV
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...