6I3ZB

Fab fragment of an antibody selective for wild-type alpha-1-antitrypsin in complex with its antigen
Total Genus 0
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
0
sequence length
34
structure length
34
Chain Sequence
PPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Characterisation of polymers extracted from the liver tissue of individuals with the MZ alpha-1-antitrypsin deficiency genotype
rcsb
molecule tags Protein binding
source organism Homo sapiens
molecule keywords Alpha-1-antitrypsin
structure length 34
sequence length 34
ec nomenclature
pdb deposition date 2018-11-08
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...