6IC8A

Crystal structure of the spoc domain of human phf3 in complex with rna polymerase ii ctd diheptapeptide phosphorylated on ser2
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
146
structure length
146
Chain Sequence
NFIWKGFINMPSVAKFVTKAYPVSGSPEYLTEDLPDSIQVGGRISPQTVWDYVEKIKASGTKEICVVRFTPVTEEDQISYTLLFAYFSSRKRYGVAANNMKQVKDMYLIPLGATDKIPHPLVPFDGPGLELHRPNLLLGLIIRQKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title PHF3 binds RNA polymerase II via the SPOC domain and negatively regulates transcription of neuronal genes
rcsb
molecule tags Protein binding
source organism Homo sapiens
molecule keywords PHD finger protein 3
total genus 41
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2018-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07744 SPOC SPOC domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...