6IK5A

Crystal structure of tomato beta-galactosidase (tbg) 4 in complex with galactose
Total Genus 237
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
237
sequence length
705
structure length
705
Chain Sequence
EFSVSYDDRAIIINGKRKILISGSIHYPRSTPQMWPDLIQKAKDGGLDVIETYVFWNGHEPSPGKYNFEGRYDLVRFIKMVQRAGLYVNLRIGPYVCAEWNFGGFPVWLKYVPGMEFRTNNQPFKVAMQGFVQKIVNMMKSENLFESQGGPIIMAQIENEYGPVEWEIGAPGKAYTKWAAQMAVGLKTGVPWIMCKQEDAPDPVIDTCNGFYCEGFRPNKPYKPKMWTEVWTGWYTKFGGPIPQRPAEDIAFSVARFVQNNGSFFNYYMYHGGTNFGRTSSGLFIATSYDYDAPLDEYGLLNEPKYGHLRDLHKAIKLSEPALVSSYAAVTSLGSNQEAHVYRSKSGACAAFLSNYDSRYSVKVTFQNRPYNLPPWSISILPDCKTAVYNTAQVNSQSSSIKMTPAGGGLSWQSYNEETPTADDSDTLTANGLWEQKNVTRDSSDYLWYMTNVNIASNEGFLKNGKDPYLTVMSAGHVLHVFVNGKLSGTVYGTLDNPKLTYSGNVKLRAGINKISLLSVSVGLPNVGVHYDTWNAGVLGPVTLSGLNEGSRNLAKQKWSYKVGLKGESLSLHSLSGSSSVEWVRGSLMAQKQPLTWYKATFNAPGGNDPLALDMASMGKGQIWINGEGVGRHWPGYIAQGDCSKCSYAGTFNEKKCQTNCGQPSQRWYHVPRSWLKPSGNLLVVFEEWGGNPTGISLVRRSRSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mechanism for the substrate recognition by glycoside hydrolase family 35 tomato beta-galactosidase (TBG) 4
rcsb
molecule keywords Beta-galactosidase
molecule tags Hydrolase
source organism Solanum lycopersicum
total genus 237
structure length 705
sequence length 705
chains with identical sequence B
ec nomenclature ec 3.2.1.23: Beta-galactosidase.
pdb deposition date 2018-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01301 Glyco_hydro_35 Glycosyl hydrolases family 35
A PF17834 GHD Beta-sandwich domain in beta galactosidase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...