6IQKA

Crystal structure of arabidopsis thaliana profilin 3
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
137
structure length
137
Chain Sequence
KKAAATNMSWQTYVDDHLMCDVAGNRLTAAAILGQDGSVWAQSNNFPQVKPEEIQGIKDDFTTPGTLAPTGLFLGGNKYMVIQGEPNAVIRGKKGAGGVTIKKTTQALVFGIYDEPMTPGQCNLVVENLGEYLIESG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Plant protein
molecule keywords Profilin-5
publication title Structural and computational examination of the Arabidopsis profilin-Poly-P complex reveals mechanistic details in profilin-regulated actin assembly.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 35
structure length 137
sequence length 137
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2018-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...