6ITZA

Peroxiredoxin from thermococcus kodakaraensis
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
213
structure length
213
Chain Sequence
VIGEKFPEVEVKTTHGVIKLPDYFAEQGKWFVLFSHPADFTPVCTTEFYAMQKRVDQFRELGVEPIGLSVDQVFSHIKWMEWIKENLGEEITFPVIADDRGELADKLGMIPSGATITARAVFIVDDKGIIRAIVYYPAEVGRDWDEILRLVKALKVSDEKGVALPHKWPNNELIGDKAIVPPASTVDEVKQREEAKAKGEIECYDWWFCYKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinct molecular assembly of homologous peroxiredoxins from Pyrococcus horikoshii and Thermococcus kodakaraensis.
pubmed doi rcsb
molecule tags Oxidoreductase
source organism Thermococcus kodakarensis kod1
molecule keywords Peroxiredoxin
total genus 65
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2018-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...