6IUIA

Crystal structure of git1 pbd domain in complex with paxillin ld4 motif
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
122
structure length
119
Chain Sequence
GLPSTEDVILKTEQVTKNIQELLRAAQEFKHDSFVPCSEKIHLAVTEMASLFPKRPALEPVRSSLRLLNASAYRLQSECRKTVPPEPVDFQLLTQQVIQCAYDIAKAAKQLVTITTREK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of the target-binding mode of the G protein-coupled receptor kinase-interacting protein in the regulation of focal adhesion dynamics.
pubmed doi rcsb
molecule tags Protein binding
source organism Rattus norvegicus
molecule keywords ARF GTPase-activating protein GIT1
total genus 46
structure length 119
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2018-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12205 GIT1_C G protein-coupled receptor kinase-interacting protein 1 C term
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...