6J0YC

Crystal structure of yeast rtt107 and slx4
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
58
structure length
58
Chain Sequence
GPLGSGSSIRVKLLQESVVKLNPKLVKHNFYRVEANDSEEEETEFDDQFCIADIQLVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The molecular mechanism of tetra-BRCT and multi-client interactions and its broad impact on genome functions
rcsb
molecule tags Protein binding
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule keywords Regulator of Ty1 transposition protein 107
total genus 8
structure length 58
sequence length 58
chains with identical sequence D
ec nomenclature
pdb deposition date 2018-12-27
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...