6J2PA

Crystal structure of saccharomyces cerevisiae spp1 in complex with h3k4me3
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
101
structure length
98
Chain Sequence
TGEDVYCICKRPDYGELMVGCDGCDDWFHFTCLHIPEQFKDLVFSFYCPYCQAGITGKNKGSLPKTLWKRKCRISDCYKPCLQDSKYCSEEHGREFVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for histone H3K4me3 recognition by the N-terminal domain of the PHD finger protein Spp1.
pubmed doi rcsb
molecule tags Protein binding
source organism Saccharomyces cerevisiae s288c
molecule keywords COMPASS component SPP1
total genus 12
structure length 98
sequence length 101
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2019-01-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...