6J5CA

Louping ill virus envelope protein
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
397
structure length
376
Chain Sequence
RCTHLEGTTRVTLVLELGGCVTITAEGKPSMDVWLDAIYQESPAKTREYCLHAKLSETKVAARCPTMGPAVLTEERQIGTVCKRDQSDRGWGNHCGLFGKGSIVACVKAACEAKKKATGYVYDANKIVYTVKVEPHTRKTATFTVSSEKTILTLGEYGDVSLLCRVASGVDLAQTIILELDKTAEHLPTAWQVHRDWFNDLALPWKHDGNPHWNNAERLVEFGAPHAVKMDVYNLGDQTGVLLRALAGVPVAHIEGNKYHLKSGHVTCEVGLEKLKMKGLTYTMCDKSKFAWKRTPTDSGHDTVVMEVTFSGSKPCRIPVRAVAHGSPDVNVAMLITPNPTIENDGGGFIEMQLPPGDNIIYVGELSHQWFQTGSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Basis of a Protective/Neutralizing Monoclonal Antibody Targeting Envelope Proteins of both Tick-Borne Encephalitis Virus and Louping Ill Virus.
pubmed doi rcsb
molecule tags Viral protein
source organism Louping ill virus
molecule keywords Envelope protein E
total genus 59
structure length 376
sequence length 397
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2019-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...