6J5UC

Ligand-triggered allosteric adp release primes a plant nlr complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
196
structure length
172
Chain Sequence
MPKGSLENHLFRRGAQPLTWAIRMKVAVGAAKGLTFLHEAKSQVIYRDFKAANILLDADFNAKLSDFTHVKVIGTHGYAAPEYVATGRLTAKSDVYSFGVVLLELISGRRAMDNYSLVDWATPYLLFRIMDTKLGGQYPQKGAFTAANLALQCLNPDAKLRPKMSEVLVTLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand-triggered allosteric ADP release primes a plant NLR complex.
pubmed doi rcsb
molecule tags Plant protein
source organism Arabidopsis thaliana
molecule keywords Disease resistance RPP13-like protein 4
total genus 24
structure length 172
sequence length 196
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2019-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...