6J6Nn

Cryo-em structure of the yeast b*-b1 complex at an average resolution of 3.86 angstrom
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
405
structure length
298
Chain Sequence
FTKSELKRRRKTRKGDGPWGSWPKKVIRNYPGHPEGTTALKFLPKTGHLILSGGNDHTIKIWDFECLRDFQGHNKPIKALRFTEDCQSFLSSSFDRSVKIWDTETGKVKTRLHLNSTPADVESRPTNPHEFIVGLSNSKILHYDDVQTYDHHLSSILALKYFPDGSKFISSSEDKTVRIWENQINVPIKQISDTASMPFLNVHPNYFCAQSMDNRIYSFSKYKRHPKKIHSSAGYGISLAFSGDGRYICSGDSKSRLFTWDWNTSRLLIPGNKPITQVDWHPSKVICSGAAGKIYVCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
pubmed doi rcsb
molecule tags Splicing
molecule keywords Pre-mRNA-splicing factor 8
total genus 32
structure length 298
sequence length 405
ec nomenclature
pdb deposition date 2019-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
n PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...