6JHFA

Crystal structure of apo pullulanase from paenibacillus barengoltzii
Total Genus 232
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
232
sequence length
673
structure length
652
Chain Sequence
SVQKEFHGTIDYGDVTVTGGISVFDAKFDELYVYDGDDLGAVYAPEETRFRLWAPTASEAFVVLYETEDGMPVKELPMKRDVQGTWTLTVAEDCGGLFYTYRVKVGEQWNEAVDPYAKAVGVNGTKTAILDLRSTNPEGWENDQKPPLASPTDAVIYELHVRDLSIHPQSGIREKGKFLGLTEEGTRGPNGIPTGLDHITGLGVTHVQLLPIYDYSQESVDESRLDEPHYNWGYDPQNYNVPEGSYSTDPHNPAARILELKRLIQKLHARGLRVIMDVVYNHVYDGYLIHFTKLVPGYYLRYKADRTFSDGTFCGNECASERPIMRKYIIESILHWVREYHIDGFRFDLMGMIDITMNEIRRRLDEIDPTILTIGEGWMMETVLPKELRANQDNAEKLPGIGMFNDGMRDAVKGDIFIFDRKGFISGGDGFEDGVKRGVAGGINYGGQLRQFAVEPVQSVNYVECHDNHTLWDKIELSTPGASDEERRAMHRLASAIVLTSQGIPFLHAGQEFMRTKGGVENSYKSPIEVNWLDWERCAAHQDDVSYMRSLIALRKAHPAFRLKTADEIRAHLRFEAAPPHTVAFTLRDHAGGDPDRHLYVLYNANPGALSLELPALGPWEVRFGGEHVLALEAGARLEVRGVGVVVLAVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of apo Pullulanase from Paenibacillus barengoltzii
rcsb
molecule keywords Pulullanase
molecule tags Hydrolase
source organism Paenibacillus barengoltzii
total genus 232
structure length 652
sequence length 673
ec nomenclature ec 3.2.1.41: Pullulanase.
pdb deposition date 2019-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02922 CBM_48 Carbohydrate-binding module 48 (Isoamylase N-terminal domain)
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...