6JJLA

Crystal structure of the degp dodecamer with a modulator
Total Genus 71
50100150200250300350010203040506070
Genus TraceResidueGenus

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
440
structure length
381
Chain Sequence
AQQMPSLAPMLEKVMPSVVSINVEQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNAGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSFNGIEGAEMSNKGKDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQ
5010015020025030035035030025020015010050
010203040506070Genus Matrix

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
AH1 (15-22)S1 (26-32)3H1 (23-25)TIV1 (32-84)S4 (112-116)TII2 (169-172)S6 (136-142)S2 (86-94)S7 (162-168)S8 (176-187)TIV2 (94-97)EMPTYS3 (99-103)TI1 (95-98)3H2 (104-106)S5 (122-129)TII1 (107-110)TIV3 (141-144)3H4 (155-157)TI2 (117-120)TVIII2 (110-113)TIV4 (159-162)TI'1 (170-173)TI3 (191-194)S9 (198-201)AH4 (298-302)TII3 (206-209)S12 (239-243)S10 (212-215)TI5 (230-233)TI4 (216-219)S11 (221-228)AH3 (274-280)S13 (267-272)TIV5 (294-297)S15 (308-310)AH5 (321-329)S16 (312-313)S17 (316-317)S18 (336-343)TII5 (332-335)S19 (346-353)TII6 (380-383)TIV10 (371-374)TIV9 (370-373)TVIII3 (189-192)TII4 (209-212)TIV8 (342-345)AH2 (244-257)S14 (287-293)3H3 (132-134)Updating...
connected with : NaN
molecule tags Hydrolase
source organism Escherichia coli k-12
publication title Crystal structure of the DegP dodecamer with a modulator
rcsb
molecule keywords Periplasmic serine endoprotease DegP
total genus 71
structure length 381
sequence length 440
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2019-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.