6K0RD

Ruvbl1-ruvbl2 with truncated domain ii in complex with phosphorylated cordycepin
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
326
structure length
303
Chain Sequence
HSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIHTVSLHEIDVINEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Circadian clock protein
molecule keywords RuvB-like 1,RuvB-like 1
publication title Chemical perturbations reveal that RUVBL2 regulates the circadian phase in mammals.
pubmed doi rcsb
source organism Homo sapiens
total genus 84
structure length 303
sequence length 326
chains with identical sequence E, F, J, K, L
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2019-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06068 TIP49 TIP49 P-loop domain
D PF17856 TIP49_C TIP49 AAA-lid domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...