6K26A

Crystal structure of vibrio cholerae methionine aminopeptidase
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
279
structure length
279
Chain Sequence
SIKIKNAVEIEKMRVAGRLAAEVLEMIEPHVKAGVTTEELDQICHKYITEVQGAIPAPLNYHGFPKSICTSINHIVCHGIPASEDTYFGQIQRPAVLRDGDILNIDITVIKDGYHGDTSKMFLIGDVSIEDKRLCHVAQECLYLALKQVKPGVQLGEIGTTIEKHIKTNNKNNPRFKFSIVRDYCGHGIGAEFHEEPQVVHYKNSDRTVLREGMIFTIEPMINAGKFGCRLDDEDSWTVYTADGKKSAQWEHTILVTATGCEILTLRSEESLPRILNNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of new variants of Methionine aminopeptidases from Vibrio species and identification of novel inhibitors
rcsb
molecule keywords Methionine aminopeptidase
molecule tags Hydrolase
source organism Vibrio cholerae
total genus 89
structure length 279
sequence length 279
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2019-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...