6K7QA

Crystal structure of thymidylate synthase from shrimp
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
285
structure length
272
Chain Sequence
MRHDEYQYLDLIRQIMRTGNRKGDRTGTGTISMFGAQMRYSLRDGIFPLLTTKRVFWRGVAEELLWFVRGSTNAKELQEKDIHIWDGDREEGDLGPVYGFQWRHFGAPYADMHTDYTGQGVDQLQQVIDTIKNNPDDRRIIMCAWNPVDVPKMALPPCHCLCQFYVANGELSCQLYQRSADMGLGVPFNIASYALLTYMIAHVTDLKPGDFVHTLGDAHVYSNHCEALEEQLKREPRPFPSLKIKRKVENISDFKFEDFELDGYKPHPKIKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of thymidylate synthase from shrimp
rcsb
molecule tags Transferase
source organism Penaeus vannamei
molecule keywords Thymidylate synthase
total genus 92
structure length 272
sequence length 285
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2019-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...