6KREZ

Tric at 0.05 mm adp-alfx, conformation 2, 0.05-c2
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
527
structure length
527
Chain Sequence
SLRRDAALKVNVTSAEGLQSVLETNLGPKGTLKMLVDGAGNIKLTKDGKVLLTEMQIQSPTAVLIARAAAAQDEITGDGTTTVVCLVGELLRQAHRFIQEGVHPRIITDGFEIARKESMKFLDEFKISKTNLSNDREFLLQVARSSLLTKVDADLTEVLTPIVTDAVLSVYDAQADNLDLHMVEIMQMQHLSPKDTTFIKGLVLDHGGRHPDMPTRVKNAYVLILNVSLEYEKTEVNSGFFYSSADQRDKLAASERKFVDAKLKKIIDLKNEVCGMDPDKGFVIINQKGIDPMSLDVFAKHNILALRRAKRRNMERLQLVTGGEAQNSVEDLSPQILGFSGLVYQETIGEEKFTYVTENTDPKSCTILIKGSTHYALAQTKDAVRDGLRAVANVLKDKNIIPGAGAFYIALSRYLRSANMNKLGAKGKTKTGIEAFAEALLVIPKTLVKNSGFDPLDVLAMVEDELDDAQDSDETRYVGVDLNIGDSCDPTIEGIWDSYRVLRNAITGATGIASNLLLCDELLRAGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An ensemble of cryo-EM structures of TRiC reveal its conformational landscape and subunit specificity.
pubmed doi rcsb
molecule tags Chaperone
molecule keywords T-complex protein 1 subunit alpha
total genus 117
structure length 527
sequence length 527
chains with identical sequence z
ec nomenclature
pdb deposition date 2019-08-21
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...