6KVHA

The mutant crystal structure of endo-polygalacturonase (t284a) from talaromyces leycettanus jcm 12802
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
336
structure length
336
Chain Sequence
ASCTFTDAASAMASKTACSTITLNNIAVPAGTTLDLTGLTSGTRVIFEGTTTFGYQEWSGPLVSISGTDITVQGASGSVLDGDGARWWDGQGSNGGKTKPKFFYAHSLDSSSITGITIKNSPVQVFSIQSNNLSLTDITVDDADGDTQGGHNTDAFDIGSSTYITITNANVHNQDDCIAVNSGENIIFTGGTCTGGHGLSIGSVGGRSDNTVKNVTIEHSTVTNSQNGVRIKTVYGATGSVSEVTYSNIQMSGIANYGIVIEQDYENGSPTGTPTNGVPITDLTLNTVTGSVSSGATEIYILCGSGSCSSWTWTGVSITGGSKSTKCENVPSGVSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The mutant crystal structure of endo-polygalacturonase (T284A) from Talaromyces leycettanus JCM 12802
rcsb
source organism Talaromyces leycettanus
molecule tags Hydrolase
molecule keywords endo-polygalacturonase
total genus 132
structure length 336
sequence length 336
ec nomenclature
pdb deposition date 2019-09-04
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...