6KZWA

Crystal structure of yggs family pyridoxal phosphate-dependent enzyme pipy from fusobacterium nucleatum
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
223
structure length
223
Chain Sequence
MSIKANVEEILEDIKKYSPYPEKVKLVAVTKYSSVEDIEKFLETGQNICGENKVQVIKDKIEYFKEKNKKIKWHFIGNLQKNKVKYIIDDVDLIHSVNKLSLAQEINKKAEQSSKIMDVLLEINVYGEESKQGYSLDELKCDIIELQNLKNLNIIGVMTMAPFTDDEKILRMVFSELRKIKDELNKEYFNNNLTELSMGMSSDYKIALQEGSTFIRVGTKIFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of YggS family pyridoxal phosphate-dependent enzyme PipY from Fusobacterium nucleatum
rcsb
molecule tags Protein binding
source organism Fusobacterium nucleatum subsp. nucleatum
molecule keywords Pyridoxal phosphate homeostasis protein
total genus 80
structure length 223
sequence length 223
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2019-09-25
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...