6L2MA

The structure of the trna-specific deaminase mutant from m. capricolum
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
147
structure length
144
Chain Sequence
DDFNNILDLLINESKKAAQLGDIPVSCCIIDSNNNILSLAINSRYKNKDISQHAEINVINDLISKLNSFNLSKYKLITTLEPCMMCYSAIKQVKINTIYYLVDDPKYSINDQNLNLIQIKNQKKQSEYIKLLNIFFINARLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Nucleoside deaminase family protein
publication title Structure of a tRNA-specific deaminase with compromised deamination activity.
pubmed doi rcsb
source organism Mycoplasma capricolum subsp. capricolum
total genus 48
structure length 144
sequence length 147
ec nomenclature
pdb deposition date 2019-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00383 dCMP_cyt_deam_1 Cytidine and deoxycytidylate deaminase zinc-binding region
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...