6L35H

Psi-lhci supercomplex from physcometrella patens
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
90
structure length
90
Chain Sequence
SVYFDLGEIDNTTGNWDLYGNDDPNRYNGFQNKFFETFAGAFTKRGLLLKFLVLGGATTIGYLGSTSSPDLLAIKNGPKQVPVMGPRGRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
publication title Antenna arrangement and energy transfer pathways of PSI-LHCI from the moss Physcometrella patens
rcsb
total genus 11
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2019-10-09
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...