6L4LA

Crystal structure of s. aureus cntk in inactive state
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
271
structure length
259
Chain Sequence
QVIEFSKYNPSGNMTILVHSKHDASEYASIANQLMAATHVCCEQVGFIESFHLVMSGNEFCGNATMSYIHHLQESHDQQFKVKVSGCSDLVQCAIHDCQYYEVQMPQAHRVVPTTINMGNHSWKALEIIYETYVHYVIPVKQVTTEIQHLVEAFVREQQWSHKYKTVGMMLFDEQRQFLQPLIYIPEIQSLIWENSCGSGTASIGVFNNYQRNDACKDFTVHQPGGSILVTSKCHQLGYQTSIKGQVTTVATGKAYIEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Diaminopimelate epimerase
publication title Crystal structure of S. aureus CntK in inactive state
rcsb
source organism Staphylococcus aureus
total genus 74
structure length 259
sequence length 271
ec nomenclature ec 5.1.1.24: Histidine racemase.
pdb deposition date 2019-10-18
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...