6L54C

Structure of smg189
Total Genus 63

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
351
structure length
308
Chain Sequence
AKLLPPERMKHSIKLVDDQMNWCDSAIEYLLDQTDVLVVGVLGLQGTGKSMVMSLLSANTPEEDQRTYVFRAQSAEMKERGGNQTSGIDFFITQERIVFLDTQPILSPSILDHLINNPEYNLPHTYVEMQSLQIAAFLFTVCHVVIVVQDWFTDLSLYRFLQTAEMVKPSTPTEYYPHLVFLQNKARREDFCPRKLRQMHLMIDQLMAHSHLRYKGTLSMLQCNVFPGLPPDFLDSEVNLPLFSLLPGYRGHPSFQSLVSKLRSQVMSMARPQLSHTILTEKNWFHYAARIWDGVRKSSALAEYSRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYS1 (184-185)TI1 (169-172)TI2 (185-188)TVIII4 (236-239)TI3 (192-195)S2 (189-190)3H1 (195-197)TVIII2 (201-204)S3 (205-211)TIV2 (212-215)3H2 (233-235)AH1 (217-226)S4 (259-261)TIV3 (241-244)TIV4 (242-245)TI5 (261-264)S5 (265-269)AH2 (276-284)TVIII1 (182-185)TVIII5 (251-254)AH3 (296-311)Updating...
connected with : NaN
molecule tags Transferase/transcription
source organism Homo sapiens
publication title Cryo-EM structure of SMG1-SMG8-SMG9 complex.
pubmed doi rcsb
molecule keywords Serine/threonine-protein kinase SMG1
total genus 63
structure length 308
sequence length 351
ec nomenclature
pdb deposition date 2019-10-22
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.